Recombinant Human CDK9/CCNK complex (CycK complex) His

Molecule:

CDK9/CCNK complex

Synonyms:

TAK, C-2k, CTK1, CDC2L4, PITALRE, CDC2-related kinase, cell division protein kinase 9, serine, threonine protein kinase PITALRE, serine, threonine-protein kinase PITALRE, cell division cycle 2-like protein kinase 4 , CPR4

Species:

Human

Cat. No.:

CSI10993 pdf (datasheet)

Quantity/Size:

10 μg

Price:

$615.00 BUY

Description:

Product: Recombinant Human Full-length protein, Histidine-tagged, expressed in insect cells. No special measures were taken to activate this kinase. Mass Spectrometry: The enzyme preparation was subjected to tryptic digestion followed by LC-MS/MS. The res

Concentration:

0.33 mg/ml (Total protein as measured using the Bradford protein assay with BSA as a standard).

Entrez Symbol:

CDK9 | CCNK

Uniprot Name:

Cell division protein kinase 9 | Cyclin-K

Uniprot ID:

P50750 | O75909

EC number:

2.7.11.22|2.7.11.23 | NA

Data PDF:

CSI10993

Genbank Accession No:

NP_001252/NP_003849

Source:

Insect cells

Molecular Weight:

46.9 kDa | 44.9 kDa

Tag:

His

Physical State:

Frozen liquid

Formulation:

Sterile filtered liquid (Frozen) in 20 mM Tris, pH 7.5 + 150 mM NaCl + 0.5 mM EDTA + 0.02% Triton�X-100 + 2 mM DTT + 50% Glycerol.

Purity:

>75% by SDS-PAGE analysis.

Specific Activity:

4.1 nmol/min/mg (phosphate transferred to CDK7/9tide substrate (YSPTSPSYSPTSPSYSPTSPS-KKKK) per minute per mg of total protein at 30�C. Activity determined at a final protein concentration of 5 �g/ml).

Amino Acid Sequence:

MSYYHHHHHHDYDIPTTENLYFQGITSLYKKAGTMAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAE

Storage/Stability:

Frozen liquid protein is stable at -80℃C for 6 months from date of purchase. For long term storage, aliquot and store at -80℃C. Avoid repeated freeze-thaw cycles.

Application notes:

The enzyme dilution buffer described is recommended for the radiometric assay format.