Recombinant Human EGF

Molecule:

EGF

Synonyms:

URG, HOMG4, Urogastrone, beta-urogastrone

Species:

Human

Cat. No.:

CRE100C pdf (datasheet)

Quantity/Size:

1.0 mg

Price:

$245.00 BUY

Description:

Background: EGF was originally discovered in crude preparations of nerve growth factor prepared from mouse submaxillary glands as an activity that induced early eyelid opening, incisor eruption, hair growth inhibition, and stunting of growth when injected

Entrez Symbol:

EGF

Uniprot Name:

Epidermal growth factor

Uniprot ID:

P01133

Data PDF:

CRE100

Source:

E. coli

Molecular Weight:

6.222 kDa

Physical State:

Lyophilized

Formulation:

Lyophilized from a sterile filtered (through a 0.2 �m filter) concentrated (1 mg/ml) solution in PBS, pH 7.4.

Purity:

>98% by SDS-PAGE and HPLC analyses.

Biological Activity:

ED50: <0.1 ng/ml (as calculated by the dose-dependant proliferation of murine BALB/c 3T3 cells (measured by 3H-thymidine uptake)).

Specific Activity:

>1 x 10E7 U/mg

Endotoxin Level:

<1/�g

Amino Acid Sequence:

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Reconstitution:

Centrifuge vial prior to opening. Reconstitute in sterile ddH2O to a concentration of 0.1-1.0 mg/ml. The solution can then be further diluted in other aqueous buffers.

Storage/Stability:

Lyophilized protein is stable at 2-4℃C, but is preferably stored desiccated at -20℃C. After reconstitution, stable for ?1 week at 2-4℃C. For long term storage, aliquot and store at -20℃C to -80℃C. Avoid repeated freeze-thaw c