Recombinant Human FGF-19 His

Molecule:

FGF19

Species:

Human

Cat. No.:

CRF011B pdf (datasheet)

Quantity/Size:

25 μg

Price:

$300.00 BUY

Description:

Background: The FGFs are a family of more than 20 small (~1726 kDa) secreted peptides. The initial characterization of these proteins focused on their ability to stimulate fibroblast proliferation. This mitogenic activity was mediated through FGF recepto

Entrez Symbol:

FGF19

Uniprot Name:

fibroblast growth factor 19

Uniprot ID:

O95750

Data PDF:

CRF011

Source:

E. coli

Molecular Weight:

23 kDa

Tag:

His

Physical State:

Lyophilized

Formulation:

Lyophilized from a sterile filtered (through a 0.4 �m filter) concentrated (0.5 mg/ ml) solution in 20 mM Tris, pH 7.5 + 20 mM NaCl.

Purity:

>95% by SDS-PAGE and HPLC analyses.

Endotoxin Level:

<0.1 ng/?g

Amino Acid Sequence:

MRGSHHHHHHGMASLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Reconstitution:

Centrifuge the vial prior to opening. Reconstitute in sterile ddH2O to a concentration of ~0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter the product by appropriate sterile filter before using for cell culture. The solution can then

Storage/Stability:

Lyophilized protein is stable at room temperature for 3 weeks, but is preferably stored desiccated at -20℃C. After reconstitution, stable for 1 week at 2-4℃C. For long term storage, aliquot and store at -20℃C with a carrier protein (0.1%