Recombinant Human G-CSF

Molecule:

G-CSF/CSF3

Synonyms:

filgrastim, lenograstim, pluripoietin, GCSF, CSF3OS, CSF-3, MGI-1G, GM-CSF beta

Species:

Human

Cat. No.:

CRG006B pdf (datasheet)

Quantity/Size:

10 μg

Price:

$300.00 BUY

Description:

Background: Granulocyte Colony Stimulating Factor is a growth factor and/or cytokine produced by the endothelium, macrophages and a number of other immune cells. GCSF stimulates the bone marrow to produce granulocytes and also to stimulate the survival, p

Entrez Symbol:

CSF3

Uniprot Name:

Granulocyte colony-stimulating factor

Uniprot ID:

P09919

Data PDF:

CRG006

Source:

CHO cells

Molecular Weight:

~18 kDa

Physical State:

Lyophilized

Formulation:

Lyophilized from a sterile filtered concentrated (1 mg/ml) solution in 10 mM Hydrochloric Acid, pH 6.5 + 0.4 mg Tween 20 + 100 mg Mannitol + 160 mg L-Arginine + 40 mg Phenylalanin + 4 mg Methionin.

Purity:

>98% by SDS-PAGE and HPLC analyses.

Biological Activity:

ED50: <0.1 ng/ml (Calculated by the dose-dependant proliferation of murine NFS-60 indicator cells (measured by 3H-thymidine uptake)).

Specific Activity:

1.27 x 10E8 IU/mg (reference standard: NISBC)

Endotoxin Level:

<0.1 ng/�g

Amino Acid Sequence:

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Reconstitution:

Centrifuge vial prior to opening. Reconstitute in sterile ddH2O to a concentration of ?0.1 mg/ml. The solution can then be further diluted in other aqueous buffers.

Storage/Stability:

Lyophilized protein is stable at room temperature for 3 weeks, but is preferably stored desiccated at -20℃C. After reconstitution, stable for 1 week at 2-4℃C. For long term storage, aliquot and store at -20℃C with a carrier protein (0.1%