Recombinant Human GDF-5

Molecule:

GDF-5

Synonyms:

CDMP-1, GDF-5, cartilage-derived morphogenetic protein 1, cartilage-derived morphogenetic protein-1, radotermin, OS5, LAP4, BMP14, CDMP1, SYNS2, BMP-14

Species:

Human

Cat. No.:

CRG009A pdf (datasheet)

Quantity/Size:

10 μg

Price:

$195.00 BUY

Description:

Background: GDF-5 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven con

Entrez Symbol:

GDF5

Uniprot Name:

Growth/differentiation factor 5

Uniprot ID:

P43026

Data PDF:

CRG009

Source:

E. coli

Molecular Weight:

26.8 kDa

Physical State:

Lyophilized

Formulation:

Lyophilized from a sterile filtered solution without additives.

Purity:

>98% by SDS-PAGE and HPLC analyses.

Biological Activity:

Induction of alkaline phosphatase acrtivity in ATDC5 cells: EC50 = 40Nm

Endotoxin Level:

<0.1 ng/�g

Amino Acid Sequence:

APSATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR.

Reconstitution:

Centrifuge vial prior to opening. Reconstitute in sterile ddH2O to a concentration of ?0.1 mg/ml. The solution can then be further diluted in other aqueous buffers.

Storage/Stability:

Lyophilized protein is stable at room temperature for 3 weeks, but is preferably stored desiccated at -20℃C. After reconstitution, stable for 1 week at 2-4℃C. For long term storage, aliquot and store at -20℃C with a carrier protein (0.1%