Recombinant Human IL-12

Molecule:

IL-12 p70

Synonyms:

P35, CLMF, NFSK, NKSF1, IL-12A, CLMF p35, IL-12 subunit p35, IL-12, subunit p35, interleukin 12, p35, interleukin-12 alpha chain, NF cell stimulatory factor chain 1, NK cell stimulatory factor chain 1, cytotoxic lymphocyte maturation factor 1, p35, cytotoxic lymphocyt

Species:

Human

Cat. No.:

CRI111A pdf (datasheet)

Quantity/Size:

2 μg

Price:

This Product is Discontinued

Description:

This product has been discontinued. Replacement items are available.

Please see items below:

CS529A  Recombinant Human IL-12 p70, 2 μg

CS529B  Recombinant Human IL-12 p70, 10 μg

CS529C  Recombinant Human IL-12 p70, 100 μg

Entrez Symbol:

IL12A | IL12B

Uniprot Name:

Interleukin-12 subunit alpha | Interleukin-12 subunit beta

Uniprot ID:

P29459 | P29460

Data PDF:

CRI111

Source:

CHO cells

Molecular Weight:

~75 kDa

Physical State:

Lyophilized

Formulation:

Lyophilized from a sterile filtered (through a 0.2 �m filter) solution in PBS, pH 7.4.

Purity:

>98% by SDS-PAGE and HPLC analyses.

Biological Activity:

ED50: 0.1-0.2 ng/ml (Measured by its ability to stimulate the proliferation of PHA-activated human T lymphoblasts).

Endotoxin Level:

<1/�g

Amino Acid Sequence:

p35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS p40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDG

Reconstitution:

Centrifuge vial prior to opening. Reconstitute in sterile ddH2O to a concentration of 0.1-1.0 mg/ml. The solution can then be further diluted in other aqueous buffers.

Storage/Stability:

Lyophilized protein is stable at 2-4℃C, but is preferably stored desiccated at -20℃C. After reconstitution, stable for ?1 week at 2-4℃C. For long term storage, aliquot and store at -20℃C to -80℃C. Avoid repeated freeze-thaw c