Recombinant Human Omentin/Intelectin-1

Molecule:

Omentin/Intelectin-1

Synonyms:

HL1, LFR, HL-1, INTL, ITLN, hIntL, ITLN-1, endothelial lectin HL-1, galactofuranose-binding lectin, intelectin-1, intestinal lactoferrin receptor

Species:

Human

Cat. No.:

CRO104C pdf (datasheet)

Quantity/Size:

1.0 mg

Price:

$6,200.00 BUY

Description:

Background: Omentin is a recently recognized gene highly localized to the mental tissue (visceral adipose tissue). Omentin is present in the stromal vascular cells in the adipose tissue rather than in the adipocytes. Omentin is predominantly expressed in

Entrez Symbol:

ITLN1

Uniprot Name:

Intelectin-1

Uniprot ID:

Q8WWA0

Data PDF:

CRO104

Source:

E. coli

Molecular Weight:

35 kDa

Physical State:

Lyophilized

Formulation:

Lyophilized from a sterile filtered solution in 5 mM Sodium Phosphate, pH 7.5 + 0.5% Mannitol.

Purity:

>95% by SDS-PAGE and HPLC analyses.

Endotoxin Level:

<0.1 ng/�g

Amino Acid Sequence:

MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFNNERAANALCAGMRVTGCNTEHHC

Reconstitution:

Centrifuge vial prior to opening. Reconstitute in sterile ddH2O to a concentration of ?0.1 mg/ml. The solution can then be further diluted in other aqueous buffers.

Storage/Stability:

Lyophilized protein is stable at room temperature for 3 weeks, but is preferably stored desiccated at -20℃C. After reconstitution, stable for 1 week at 2-4℃C. For long term storage, aliquot and store at -20℃C with a carrier protein (0.1%