Recombinant Human IL2-inducible T-cell Kinase GST

Molecule:

ITK

Synonyms:

EMT, LYK, PSCTK2, kinase EMT, T-cell-specific kinase, tyrosine-protein kinase LYK, homolog of mouse T-cell itk, tsk

Species:

Human

Cat. No.:

CSI12093 pdf (datasheet)

Quantity/Size:

10 μg

Price:

$615.00 BUY

Description:

Product: Recombinant Human Full-Length protein, GST-tagged, expressed in insect cells. Activated in vitro via auto-phosphorylation. Mass Spectrometry: The enzyme preparation was subjected to tryptic digestion followed by LC-MS/MS. The resulting MS/MS data

Concentration:

0.36 mg/ml (total protein as measured using the Bradford protein assay with BSA as a standard).

Entrez Symbol:

ITK

Uniprot Name:

Tyrosine-protein kinase ITK/TSK

Uniprot ID:

Q08881

EC number:

2.7.10.2

Data PDF:

CSI12093

Genbank Accession No:

NP_057207

Source:

Insect cells

Molecular Weight:

99.9 kDa

Tag:

GST

Physical State:

Frozen liquid

Formulation:

Sterile filtered liquid (Frozen) in 50 mM Tris-HCl buffer, pH 7.5 + 150 mM NaCl + 0.5 mM EDTA + 0.02% Triton X-100 + 2 mM DTT + 50% Glycerol.

Purity:

90% by SDS-PAGE analysis.

Specific Activity:

160 nmol/min/mg (phosphate transferred to myelin basic protein (MBP) per minute per mg of total protein at 30�C. Activity determined at a final protein concentration of 2.08 �g/ml).

Amino Acid Sequence:

MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRHNQTSLYKKAGFEGDRTMNNFILLEEQLIKK

Storage/Stability:

Frozen liquid protein is stable at -80℃C for 6 months from date of purchase. For long term storage, aliquot and store at -80℃C. Avoid repeated freeze-thaw cycles.

Application notes:

The dilution buffer described above is recommended for the radiometric assay format. For high throughput applications such as PolarScreen, Z'-LYTE, and LanthaScreen, modifications to this buffer are needed.