Recombinant Human TNF-beta

Molecule:

TNF-beta

Synonyms:

LT-alpha, TNF-beta, Tumor necrosis factor ligand superfamily member 1, LT, TNFB, TNFSF1, LT-alpha, TNF-beta, tumor necrosis factor beta, tumor necrosis factor ligand superfamily member 1

Species:

Human

Cat. No.:

CRT103B pdf (datasheet)

Quantity/Size:

20 μg

Price:

$300.00 BUY

Description:

Background: Lymphotoxin alpha, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. LTA is highly inducible, secreted, and exists as homotrimeric molecule. LTA forms heterotrimers with lymphotoxin-beta which anchors lymphot

Entrez Symbol:

LTA

Uniprot Name:

Lymphotoxin-alpha

Uniprot ID:

P01374

Data PDF:

CRT103

Source:

E. coli

Molecular Weight:

18.645 kDa

Physical State:

Lyophilized

Formulation:

Lyophilized from a sterile filtered solution without additives.

Purity:

>98% by SDS-PAGE and HPLC analyses.

Biological Activity:

ED50 : <0.05 ng/ml (determined by the cytolysis of murine L929 cells in the presence of Actinomycin D).

Specific Activity:

2 x 10E7 IU/mg (reference standard:NISBC)

Endotoxin Level:

<0.1 ng/�g

Amino Acid Sequence:

MLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL.

Reconstitution:

Centrifuge vial prior to opening. Reconstitute in sterile ddH2O to a concentration of ?0.1 mg/ml. The solution can then be further diluted in other aqueous buffers.

Storage/Stability:

Lyophilized protein is stable at 2-4℃C for 3 weeks, but is preferably stored desiccated at -20℃C. After reconstitution, stable for 1 week at 2-4℃C. For long term storage, store with a carrier protein (0.1% HSA or BSA) at -20℃C. Avo