Recombinant Mouse MIP-1 beta/CCL4

Molecule:

MIP-1 beta

Synonyms:

ACT2, MIP-1 beta, MIP-1-beta, SIS-gamma, immune activation protein 2, macrophage inflammatory protein 1-beta, small inducible cytokine A4, small-inducible cytokine A4, Act-2, Mip1b, Scya4, MIP-1B, MIP-1-beta(1-69), T-cell activation protein 2, PAT 744, H400, Lymphocyte a

Species:

Mouse

Cat. No.:

CRM413B pdf (datasheet)

Quantity/Size:

10 μg

Price:

$235.00 BUY

Description:

Background: Macrophage Inflammatory Proteins (MIP) belong to the family of chemotactic cytokines known as chemokines. In humans, there are two major forms, MIP-1 alpha and MIP-1 beta that are now officially named CCL3 and CCL4 respectively. Both are major

Entrez Symbol:

Ccl4

Uniprot Name:

C-C motif chemokine 4

Uniprot ID:

P14097

Data PDF:

CRM413

Source:

E. coli

Molecular Weight:

7.808 kDa

Physical State:

Lyophilized

Formulation:

Lyophilized from a sterile filtered concentrated (1 mg/ ml) solution in water without additives.

Purity:

>98% by SDS-PAGE and HPLC analyses.

Biological Activity:

Mouse MIP-1 beta activity is calculated by the ability to chemoattract Human blood monocytes at 20-100 ng/ml.

Endotoxin Level:

<0.1 ng/�g

Amino Acid Sequence:

APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Reconstitution:

Centrifuge vial prior to opening. Reconstitute in sterile ddH2O to a concentration of ?0.1 mg/ml. The solution can then be further diluted in other aqueous buffers.

Storage/Stability:

Lyophilized protein is stable at room temperature for 3 weeks, but is preferably stored desiccated at -20℃C. After reconstitution, stable for 1 week at 2-4℃C. For long term storage, aliquot and store at -20℃C with a carrier protein (0.1%