Recombinant Protein G

Molecule:

PROC/Protein G

Cat. No.:

CRP154C pdf (datasheet)

Quantity/Size:

100 mg

Price:

$690.00 BUY

Description:

Background: The Protein G contains amino acids 190-384 having a molecular mass of 21.6 kDa. The Protein-G migrates on SDS-PAGE around 32 kDa. Specificity: 1. Binds with greater affinity to most mammalian immunoglobulins than Protein A, including human IgG

Data PDF:

CRP154

Source:

E. coli

Molecular Weight:

21.6 kDa

Physical State:

Lyophilized

Formulation:

Lyophilized from a sterile filtered solution without additive.

Purity:

>95% by SDS-PAGE and HPLC analyses.

Endotoxin Level:

<0.1 ng/�g

Amino Acid Sequence:

MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE

Reconstitution:

Centrifuge vial prior to opening. Reconstitute in sterile ddH2O or PBS. The solution can then be further diluted in other aqueous buffers.

Storage/Stability:

Lyophilized protein is stable at -20℃C for 2 years. After reconstitution, aliquot and store at -20℃C. Avoid repeated freeze-thaw cycles.