Synthetic Human LL37 Peptide, Free Ends

Molecule:

LL37

Synonyms:

LL37, CAMP, CAP18, CRAMP, FALL39, HSD26, FALL-39, CAP-18

Species:

Human

Cat. No.:

CSI17694B pdf (datasheet)

Quantity/Size:

100 μg

Price:

$135.00 BUY

Description:

Synthetic Human LL37 (free ends) peptide. Peptide content 83%.

Entrez Symbol:

CAMP

Data PDF:

CSI17694

Source:

Synthetic

Molecular Weight:

4.49 kDa

Physical State:

Lyophilized

Formulation:

Lyophilized

Purity:

95.00%

Endotoxin Level:

<0.1 ng/οΨΒg of protein

Amino Acid Sequence:

[LL-37, 37 aa]OH

Storage/Stability:

Peptides should be stored lyophilized at -20οΨΑC to -80οΨΑC and kept desiccated whenever possible. Avoid multiple freeze-thaw cycles.