Molecule:
CDK9/CCNT1 complex
Synonyms:
TAK, C-2k, CTK1, CDC2L4, PITALRE, CDC2-related kinase, cell division protein kinase 9, serine, threonine protein kinase PITALRE, serine, threonine-protein kinase PITALRE, cell division cycle 2-like protein kinase 4 , CCNT, CYCT1, HIVE1, cyclin-T, cyclin T1b, cyclin C-rel
Description:
Product: Recombinant Human full length CDK9/Cyclin T1 complex, Histidine-tagged, expressed in insect cells. No special measures were taken to activate this kinase.Mass Spectrometry: The enzyme preparation was subjected to tryptic digestion followed by LC
Concentration:
0.26 mg/ml (total protein as measured using the Bradford protein assay with BSA as a standard).
Entrez Symbol:
CDK9 | CCNT1
Uniprot Name:
Cell division protein kinase 9 | Cyclin-T1
Uniprot ID:
P50750 | O60563
EC number:
CDK9 - 2.7.11.22 | 2.7.11.23
Genbank Accession No:
NP_001252 | NP_001231
Molecular Weight:
46.9 kDa | 84.8 kDa
Physical State:
Frozen liquid
Formulation:
Sterile filtered liquid (Frozen) in 50 mM Tris Buffer, pH 7.5 + 150 mM NaCl + 0.5 mM EDTA + 0.02% Triton� X-100 + 2 mM DTT + 50% Glycerol.
Purity:
>70% by SDS-PAGE analysis.
Specific Activity:
59 nmol/min/mg (phosphate transferred to CDK7/9tide substrate (YSPTSPSYSPTSPSYSPTSPS-KKKK) per minute per mg of total protein at 30�C. Activity determined at a final protein concentration of 3.33 ?g/ml).
Amino Acid Sequence:
MSYYHHHHHHDYDIPTTENLYFQGITSLYKKAGTMAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAE
Storage/Stability:
Frozen liquid protein is stable at -80℃C for 6 months from date of purchase. For long term storage, aliquot and store at -80℃C. Avoid repeated freeze-thaw cycles.
Application notes:
The dilution buffer described is recommended for the radiometric assay format. For high throughput applications such as PolarScreen, Z'-LYTE, and LanthaScreen, modifications to this buffer are needed.