Synonyms:
Beta-urogastrone, Urogastrone, EGF-URO, HMGF, PGF, URG
Description:
Epidermal Growth Factor (EGF) was originally discovered in crude preparations of nerve growth factor prepared from mouse submaxillary glands as an activity that induced early eyelid opening, incisor eruption, hair growth inhibition, and stunting of growth when injected into newborn mice. Human EGF was isolated from urine based on its inhibitory effect on gastric secretion and named urogastrone, accordingly. EGF is prototypic of a family of growth factors that are derived from membrane-anchored precursors. All members of this family are characterized by the presence of at least one EGF structural unit (defined by the presence of a conserved 6 cysteine motif that forms three disulfide bonds) in their extracellular domain. EGF is initially synthesized as a 130 kDa precursor transmembrane protein containing 9 EGF units. The mature soluble EGF sequence corresponds to the EGF unit located proximal to the trans-membrane domain. The membrane EGF precursor is capable of binding to the EGF receptor and was reported to be biologically active.
Uniprot Name:
Epidermal growth factor
Molecular Weight:
6.2 kDa (53 aa)
Physical State:
Lyophilized
Formulation:
Sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Purity:
> 95% by reducing and non-reducing SDS-PAGE
Biological Activity:
ED50 < 100 pg/ml, determined by a cell proliferation assay using mouse Balb/c 3T3.
Specific Activity:
> 1.0 × 107 U/mg The specific activity of Human EGF is approximately 1.3 x 10^3 IU/μg, which is calibrated against recombinant human EGF WHO International Standard (NIBSC code: 91/530).
Endotoxin Level:
< 1EU/μg determined by kinetic LAL analysis.
Amino Acid Sequence:
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Reconstitution:
Centrifuge vial prior to opening. Reconstitute in sterile ddH2O to a concentration of 0.1-1.0 mg/ml. The solution can then be further diluted in other aqueous buffers.
Storage/Stability:
Store as supplied at -20°C to -80°C for up to 1 year