Recombinant Human CD105 / Endoglin, soluble

Synonyms:

ENG, CD105

Species:

Human

Cat. No.:

CRC806B pdf (datasheet)

Quantity/Size:

25 μg

Price:

$685.00 BUY

Description:

Endoglin, also known as CD105, is a Type I integral membrane glycoprotein with a large, disulfide-linked, extracellular region and a short, constitutively phosphorylated, cytoplasmic tail. Two splice variants of human Endoglin, the S-Endoglin and L-Endoglin that differ in the length of their cytoplasmic tails have been identified. Endoglin is highly expressed on vascular endothelial cells, chondrocytes, and syncytiotrophoblasts of term placenta. It is also found on activated monocytes, bone marrow pro-erythroblasts, and leukemic cells of lymphoid and myeloid lineages. Human and mouse Endoglin share approximately 70% and 97 % amino acid sequence identity in their extracellular and intracellular domains, respectively. Endoglin has been shown to be a powerful marker of neovascularization. It is also useful as a functional marker that defines long-term repopulating hematopoietic stem cells.

Data PDF:

CRC806

Source:

Insect cells

Molecular Weight:

70 - 75 kDa (565 aa) disulfide-linked homodimer, predicted 61 kDa

Tag:

His

Formulation:

Lyophilized from PBS

Purity:

>90% by SDS-PAGE, visualized by silver stain

Biological Activity:

in progress

Amino Acid Sequence:

ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQA SKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKT QILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPAL VRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWL IDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIV SLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCT ITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHC LNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEG GTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQD QEVHRTVFMRLNIISPDLSGCTSHHHHHH

Storage/Stability:

Stable at -20°C to -80° for up to 1 year.