Recombinant Human FGFR1 (IIIc)/Fc Chimera

Molecule:

FGFR1 (IIIc)/Fc Chimera

Synonyms:

FGFR1, Fibroblast growth factor receptor 1/Fc chimera

Species:

Human

Cat. No.:

CRF016A pdf (datasheet)

Quantity/Size:

10 μg

Price:

$250.00 BUY

Description:

Recombinant human soluble FGFR-1a (IIIc) was fused via a Xa cleavage site with the Fc part of human IgG1. Human recombinant soluble FGFR-1a (IIIc)/Fc is a disulfide-linked heterodimeric protein.

Fibroblast Growth Factors (FGFs) comprise a family of at least eighteen structurally related proteins that are involved in a multitude of physiological and pathological cellular processes, including cell growth, differentation, angiogenesis, wound healing and tumorgenesis. The biological activities of the FGFs are mediated by a family of type I transmembrane tyrosine kinases which undergo dimerization and autophosphorylation after ligand binding.

Entrez Symbol:

FGFR1

Uniprot ID:

P11362

EC number:

2.7.10.1

Data PDF:

CRF016

Source:

Insect cells

Molecular Weight:

~130 kDa, predicted, dimer (601 aa) ~170 kDa, apparent, due to glycosylation

Formulation:

Lyophilized from a sterile filtered solution in PBS without additives.

Purity:

> 90%, by SDS-PAGE and visualized by silver stain

Biological Activity:

Determined by its ability to inhibit human FGF basic-dependent proliferation on HUVE cells.

Endotoxin Level:

< 1 EU/mg sFGF-R1a

Amino Acid Sequence:

RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRT RITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSE EKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNG KEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPH RPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKT AGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSP LYLEDPRRASIEGRGDPEEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK

Storage/Stability:

Store lyophilized product at -20°C to -80°C.