Synonyms:
P35, CLMF, NFSK, NKSF1, IL-12A, CLMF p35, IL-12 subunit p35, IL-12, subunit p35, interleukin 12, p35, interleukin-12 alpha chain, NF cell stimulatory factor chain 1, NK cell stimulatory factor chain 1, cytotoxic lymphocyte maturation factor 1, p35, cytotoxic lymphocyt
Description:
This product has been discontinued. Replacement items are available.
Please see items below:
CS529A Recombinant Human IL-12 p70, 2 μg
CS529B Recombinant Human IL-12 p70, 10 μg
CS529C Recombinant Human IL-12 p70, 100 μg
Entrez Symbol:
IL12A | IL12B
Uniprot Name:
Interleukin-12 subunit alpha | Interleukin-12 subunit beta
Uniprot ID:
P29459 | P29460
Molecular Weight:
~75 kDa
Physical State:
Lyophilized
Formulation:
Lyophilized from a sterile filtered (through a 0.2 �m filter) solution in PBS, pH 7.4.
Purity:
>98% by SDS-PAGE and HPLC analyses.
Biological Activity:
ED50: 0.1-0.2 ng/ml (Measured by its ability to stimulate the proliferation of PHA-activated human T lymphoblasts).
Amino Acid Sequence:
p35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS p40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDG
Reconstitution:
Centrifuge vial prior to opening. Reconstitute in sterile ddH2O to a concentration of 0.1-1.0 mg/ml. The solution can then be further diluted in other aqueous buffers.
Storage/Stability:
Lyophilized protein is stable at 2-4℃C, but is preferably stored desiccated at -20℃C. After reconstitution, stable for ?1 week at 2-4℃C. For long term storage, aliquot and store at -20℃C to -80℃C. Avoid repeated freeze-thaw c