Recombinant Human PGF His

Molecule:

PGF

Synonyms:

PGF, PlGF-1

Species:

Human

Cat. No.:

CRP203C pdf (datasheet)

Quantity/Size:

1.0 mg

Description:

Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversial. In several reports it was shown not to be a potent mitogen for endotehlial cells and not angiogenic in vivo by using different assays. Very recently it was shown by one investigator, that PlGF-1 from cell culture supernatants was angiogenic in the CAM assay and in the rabbit cornea assay. At least one high-affinity receptor for PlGF (FLT-1 or VEGF-R1) has been demonstrated in different primary cell types (e.g. human umbilical vein endothelial cells and monocytes) but PlGF does not bind to KDR/flk-1. Two different proteins can be generated by differential splicing of the human PlGF gene: PlGF-1 (131 aa native chain) and PlGF-2 (152 aa native chain). Both mitogens are secretable proteins, but PlGF-2 can bind to heparin with high affinity. PlGF-1 is a homodimer, but preparations of PlGF show some heterogeneity on SDS gels depending of the varying degrees of glycosylation. All dimeric forms posses a similar biological profile. There is good evidence that heterodimeric molecules between VEGF and PlGF exists and that they are biologically active. Different cells and tissues (e.g. placenta) express PlGF-1 and PlGF-2 at different rates. Related proteins of PlGF are VEGF with about 53% homology and VEGF-B with a similar biological activity.

Entrez Symbol:

PGF

Uniprot ID:

P49763

Data PDF:

CRP203

Source:

Insect cells

Molecular Weight:

19 kDa (139 aa) predicted 36.4 kDa, apparent due to glycosylation

Tag:

His

Formulation:

Lyophilized from a sterile filtered solution containing BSA as a stabilizer.

Purity:

>95.0% as determined by SDS-PAGE analysis and visualized by silver stain

Biological Activity:

Determined by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant human PLGF-1 can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/ml.

Endotoxin Level:

<1 EU/µg

Amino Acid Sequence:

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSP SCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPL REKMKPERCGDAVPRRTRHHHHHH

Storage/Stability:

Stable for 1 year at -20°C to -80°C.