Recombinant Human TIE-2 / Fc Chimera, Soluble

Molecule:

TEK/TIE-2

Synonyms:

Angiopoietin-1 receptor, Endothelial tyrosine kinase, p140 TEK, CD202b

Species:

Human

Cat. No.:

CRT801B pdf (datasheet)

Quantity/Size:

100 μg

Price:

$560.00 BUY

Description:

Recombinant human soluble TEK was fused with the Fc part of human IgG1. The recombinant mature TEK/Fc is a disulfide-linked homodimeric protein. The soluble receptor protein consists of the full extracellular domain (Met1-Val730). TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TEK (TIE2) comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Human TEK cDNA encodes a 1124 amino acid residue precursor protein with an 18 residue putative signal peptide, a 727 residue extracellular domain and a 354 residue cytoplasmic domain. Two ligands, angiopoietin 1 and angiopoietin 2, which bind TEK with high-affinity have been identified. Angiopoietin 2 has been reported to act as an antagonist for Angiopoietin 1. Mice engineered to over express Angiopoietin 2 or to lack Angiopoietin 1 or TEK display similar angiogenic defects.

Entrez Symbol:

TEK

Uniprot ID:

Q02763

Data PDF:

CRT801

Source:

Insect cells

Molecular Weight:

105 kDa predicted, monomer, under reducing conditions 125 kDa apparent, due to glycosylation

Formulation:

Lyophilized from PBS

Purity:

> 90% as determined by SDS-PAGE, visualized by silver stain

Endotoxin Level:

< 1 EU/µg

Amino Acid Sequence:

AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREW AKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNI SFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSA FTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTF GRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCS CNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIEVNSGKFNPICKASG WPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMV EKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQH IQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPK SQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLLNNLHPREQYVV RARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYK VQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHELVTRSDK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPML DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Storage/Stability:

Stable at -20°C to -80° for up to 1 year.