Recombinant Human soluble VEGFR1 / FLT1 (D1-4)

Molecule:

VEGFR1/FLT1

Synonyms:

FLT1, FLT-1, VEGFR-1, fms-like tyrosine kinase 1, tyrosine-protein kinase FRT, tyrosine-protein kinase receptor FLT, vascular endothelial growth factor receptor 1, vascular permeability factor receptor, FLT

Species:

Human

Cat. No.:

CRF111B pdf (datasheet)

Quantity/Size:

20 μg

Price:

$395.00 BUY

Description:

Recombinant Human soluble Vascular Endothelial Growth Factor Receptor-1 domain D1 -4 is produced as a non-chimeric protein in a monomeric form. The soluble receptor protein contains only the first 4 extracellular domains, which contain all the information necessary for binding of VEGF. Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), VEGFR-3 (Flt -4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes, dendritic cells and on trophoblast cells. The flt-1 gene was first described in 1990. The receptor contains seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular split tyrosine kinase domain. Compared to VEGFR-2 the Flt-1 receptor has a higher affinity for VEGF but a weaker signaling activity. VEGFR-1 thus leads not to proliferation of endothelial cells, but mediates signals for differentiation. Interestingly a naturally occuring soluble variant of VEGFR-1 (sVEGFR-1) was found in HUVEC supernatants in 1996, which is generated by alternative splicing of the flt-1 mRNA. The biological functions of sVEGFR-1 still are not clear, but it seems to be an endogenous regulator of angiogenesis, binding VEGF with the same affinity as the full-length receptor.

Entrez Symbol:

FLT1

Uniprot Name:

Vascular endothelial growth factor receptor 1

Uniprot ID:

P17948

Data PDF:

CRF111

Source:

Insect cells

Molecular Weight:

55 kDa

Formulation:

Lyophilized from a sterile filtered solution without additives.

Purity:

>90% by SDS-PAGE analysis.

Biological Activity:

The activity of sVEGFR-1D1-4 was determined by its ability to abolish the binding of iodinated VEGF to solid surfaces or cell surfaces, and in Far-Western and cross-linking experiments with iodinated VEGF.

Endotoxin Level:

< 1.0 EU/µg

Amino Acid Sequence:

SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRN GKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEII HMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEA TVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYP DEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI YDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRG YSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSR QILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFC

Storage/Stability:

Stable for up to 1 year at -20°C to -80°C.