Recombinant Human soluble VEGFR3 / FLT4 (Fc Chimera)

Molecule:

VEGFR3/FLT4

Synonyms:

FLT4, Vascular endothelial growth factor receptor 3, Fms-like tyrosine kinase 4, FLT-4

Species:

Human

Cat. No.:

CRF100C pdf (datasheet)

Quantity/Size:

1.0 mg

Description:

Recombinant human Vascular Endothelial Growth Factor Receptor-3 was fused with the Fc part of human IgG1. The soluble receptor protein consists of all 7 extracellular domains (Met1-Glu774). All three VEGF receptors belong to the class III subfamily of receptor tyrosine kinases (RTKs) characterized by the seven immunoglobulin-like loops in the extracellular domain. The expression of VEGFR-1 to -3 is almost exclusively restricted to haematopoietic precursor cells, vascular and lymphatic endothelial cells and to the monocyte/macrophage lineage. They play key roles in vasculogenesis, hematopoiesis, angiogenesis and lymphangiogenesis.

Entrez Symbol:

FLT4

Uniprot ID:

P35916

EC number:

2.7.10.1

Data PDF:

CRF100

Source:

Insect cells

Molecular Weight:

130 kDa (979 aa) predicted, homodimer

Formulation:

Lyophilized from a sterile filtered solution in PBS without additives.

Purity:

>90% by SDS-PAGE analysis.

Biological Activity:

Measured by its ability to bind recombinant rat VEGF-C in a functional solid phase binding assay. Immobilized recombinant human sVEGFR-3/Fc at 5 μg/ml can bind recombinant rat VEGF-C in a linear range of 8-500 ng/ml.

Endotoxin Level:

< 1 EU/µg

Amino Acid Sequence:

: YSMTPPTLNITEDSYVIDTGDSLSISCRGQHPLEWTWPGAQEVLTTGGKDSEDTRVVHD CEGTEARPYCKVLLLAQTHANNTGSYHCYYKYIKARIEGTTAASTYVFVRDFKHPFINKP DTLLVNRKDSMWVPCLVSIPGLNITLRSQSSALHPDGQEVLWDDRRGMRVPTQLLRDA LYLQCETTWGDQNFLSNLFVVHITGNELYDIQLYPKKSMELLVGEKLVLNCTVWAEFDS GVTFDWDYPGKQAERAKWVPERRSQQTHTELSSILTIHNVSQNDLGPYVCEANNGIQR FRESTEVIVHEKPFISVEWLKGPVLEATAGDELVKLPVKLAAYPPPEFQWYKDRKAVTG RHNPHALVLKEVTEASAGVYTLALWNSAAGLRQNISLELVVNVPPHIHEKEASSPSIYSR HSRQTLTCTAYGVPQPLSVQWHWRPWTPCKTFAQRSLRRRQQRDGMPQCRDWKEV TTQDAVNPIESLDSWTEFVEGKNKTVSKLVIQDANVSAMYKCVVVNKVGQDERLIYFYV TTIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLSTLHDAQGNPLLLDC KNVHLFATPLEANLEEAEPGARHATLSLNIPRVAPEDEGDYVCEVQDRRSQDKHCHKK YLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEKESGIDLA DSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMESDKTHTCPP CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Storage/Stability:

Stable at -20℃C to -80℃C for >6 months.