Recombinant Human soluble VEGFR3 / FLT4 His

Molecule:

VEGFR3/FLT4

Synonyms:

FLT41, LMPH1A, PCL, VEGFR3, FLT-4, VEGFR-3, fms-like tyrosine kinase 4, soluble VEGFR3 variant 1, soluble VEGFR3 variant 2, soluble VEGFR3 variant 3, Fms-like tyrosine kinase 4

Species:

Human

Cat. No.:

CRF113B pdf (datasheet)

Quantity/Size:

50 μg

Price:

$615.00 BUY

Description:

Recombinant human soluble VEGFR3 was fused with a C-terminal 6X histidine-tag. The recombinant mature sVEGFR3 is a glycosylated monomeric protein, consisting of all 7 extracellular domains (Met1-Glu774).

All three VEGF receptors belong to the class III subfamily of receptor tyrosine kinases (RTKs) characterized by the seven immunoglobulin-like loops in the extracellular domain. The expression of VEGFR-1 to -3 is almost exclusively restricted to hematopoietic precursor cells, vascular and lymphatic endothelial cells and to the monocyte/macrophage lineage. They play key roles in vasculogenesis, hematopoiesis, angiogenesis and lymphangiogenesis. The VEGFR3 cDNA encodes a 1298 amino acid (aa) residue precursor protein with a 23 aa residue signal peptide. Mature VEGFR3 is composed of a 751 aa residue extracellular domain, a 22 aa transmembrane domain and a 482 aa residue cytoplasmic domain. Both VEGF family members VEGFC and VEGFD have been shown to bind and activate VEGFR3. The VEGFR3 gene is widely expressed in the early embryo but becomes restricted to the lymphatic endothelial at later stages of development. It is important for lymphangiogenesis.

Entrez Symbol:

FLT4

Uniprot Name:

Vascular endothelial growth factor receptor 3

Uniprot ID:

P35916

EC number:

2.7.10.1

Data PDF:

CRF113B

Source:

Insect cells

Molecular Weight:

110 kDa (761 aa)

Tag:

His

Formulation:

Lyophilized from a sterile filtered solution in PBS without additives.

Purity:

>90% by SDS-PAGE analysis.

Biological Activity:

Measured by its ability to bind recombinant rat VEGF-C in a functional solid phase binding assay. Immobilized recombinant human sVEGFR-3/FLT-4 at 5µg/ml can bind recombinant rat VEGF-C in a linear range of 8-500ng/ml.

Endotoxin Level:

< 1 EU/µg

Amino Acid Sequence:

DPSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDT GVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQ PFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVST PLLHDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPRKSLELLVGEKLVLNCTVW AEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNVSQHDLGSYVCKAN NGIQRFRESTEVIVHENPFISVEWLKGPILEATAGDELVKLPVKLAAYPPPEFQWYKDGK ALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNVPPQIHEKEASSPS IYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQDLMPQCRDW RAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKVGQDERLIY FYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLL DCKNVHLFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRSHDKHCH KKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEEKSGVD LADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEHHHHHH

Storage/Stability:

Stable for 1 year at -20°C to -80°C.