Recombinant Mouse CD105 / Endoglin, soluble

Synonyms:

Eng, Cell surface Mj7/18, CD105

Species:

Mouse

Cat. No.:

CRC805C pdf (datasheet)

Quantity/Size:

1.0 mg

Description:

Endoglin, also known as CD105, is a Type I integral membrane glycoprotein with a large, disulfide-linked, extracellular region and a short, constitutively phosphorylated, cytoplasmic tail. Two splice variants of human endoglin, the S-endoglin and L-endoglin that differ in the length of their cytoplasmic tails have been identified. Endoglin is highly expressed on vascular endothelial cells, chondrocytes, and syncytiotrophoblasts of term placenta. It is also found on activated monocytes, bone marrow pro-erythroblasts, and leukemic cells of lymphoid and myeloid lineages. Human and mouse endoglin share approximately 70% and 97 % amino acid sequence identity in their extracellular and intracellular domains, respectively. In common with betaglycan (also named TßRIII), a proteoglycan that shares regions of sequence similarity, endoglin is an accessory receptor for the TGF superfamily ligands.

Entrez Symbol:

Eng

Uniprot ID:

Q63961

Data PDF:

CRC805

Source:

Insect cells

Molecular Weight:

70-75 kDa (558 aa) disulfide-linked homodimer, predicted 61 kDa

Tag:

His

Formulation:

Lyophilized from PBS

Purity:

> 90% by SDS-PAGE, visualized by silver stain.

Biological Activity:

Measured by its ability to bind with TGF-β RII/Fc in a functional ELISA

Endotoxin Level:

< 1 EU/µg

Amino Acid Sequence:

ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQ ASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSR KQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQT PVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDI NHSMQILTTGEYSVKIFPGSKDKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLR ASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTIT GLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCID MDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDM VELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVY KTVSMRLNIVSPDLSHHHHHH

Storage/Stability:

Stable at -20°C to -80° for up to 1 year.