Recombinant Mouse IL-19 Animal Free

Synonyms:

Interleukin 19

Species:

Mouse

Cat. No.:

CRM428C-AF pdf (datasheet)

Quantity/Size:

1 mg

Price:

$5,300.00 / Special Price: $4,100.00 BUY

Description:

Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-α) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.

Manufactured without Animal-derived products, in an Animal Free facility.

Entrez Symbol:

Il19

Uniprot Name:

Interleukin-19

Uniprot ID:

Q8CJ70

Data PDF:

CRM428-AF

Source:

E. coli

Molecular Weight:

Monomer, 17.7 kDa (153 aa)

Physical State:

Lyophilized

Formulation:

Sterile-filtered solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5

Purity:

≥95% by reducing and non-reducing SDS-PAGE

Endotoxin Level:

≤1 EU/µg by kinetic LAL analysis

Amino Acid Sequence:

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Storage/Stability:

Store as supplied at -20°C to -80°C for up to 1 year.