Recombinant Mouse LYVE-1 His-Tag, soluble

Synonyms:

Lyve1, Lymphatic vessel endothelial hyaluronic acid receptor 1, Cell surface retention sequencebinding protein 1, CRSBP-1, Hyaluronic acid receptor

Species:

Mouse

Cat. No.:

CRL605A pdf (datasheet)

Quantity/Size:

20 μg

Price:

$320.00 BUY

Description:

A DNA sequence encoding the extracellular domain of human LYVE-1 (Met1 to Gly232) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on Nterminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ser24. LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymphspecific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves.

Entrez Symbol:

Lyve1

Uniprot ID:

Q8BHC0

Data PDF:

CRL605

Source:

Insect cells

Molecular Weight:

25 kDa (211 aa) predicted, monomer 35-45 kDa, apparent, due to glycosylation, reducing conditions

Tag:

His

Formulation:

Lyophilized from PBS.

Purity:

> 95% by SDS-PAGE visualized by silver stain

Biological Activity:

Not available.

Endotoxin Level:

< 1 EU/µg

Amino Acid Sequence:

ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGF ETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCI PEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITE VYTEPITMATETEAFVASGAAFKNEAAGHHHHHH

Storage/Stability:

Stable for 1 year at -20°C to -80°C.