Recombinant Mouse TIE-2 / Fc Chimera

Molecule:

TEK/TIE-2

Synonyms:

Tek, Angiopoietin-1 receptor, Tyrosine-protein kinase receptor TEK, Tunica interna endothelial cell kinase, CD202b, p140 TEK

Species:

Mouse

Cat. No.:

CRT803A pdf (datasheet)

Quantity/Size:

20 μg

Price:

$250.00 BUY

Description:

Recombinant mouse soluble TIE-2 was fused with the Fc part of human IgG1. The recombinant mature sTIE-2/Fc is a disulfide-linked homodimeric protein. The soluble receptor protein consists of the full extracellular domain (Val19-Leu740).

TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Human TIE-1 cDNA encodes a 1122 amino acid (aa) residue precursor protein with an 18 residue putative signal peptide, a 726 residue extracellular domain and a 353 residue cytoplasmic domain. Two ligands, angiopoietin-1 (Ang1) and angiopoietin-2 (Ang2), which bind TIE-2 with high-affinity have been identified. Ang2 has been reported to act as an antagonist for Ang1. Mice engineered to over express Ang2 or to lack Ang1 or Tie-1 display similar angiogenic defects.

Entrez Symbol:

Tek

Uniprot ID:

Q02858

Data PDF:

CRT803

Source:

CHO cells

Molecular Weight:

105 kDa predicted, monomer, under reducing conditions 140 kDa apparent, due to glycosylation

Formulation:

Lyophilized from PBS

Purity:

> 90%, by SDS-PAGE, visualized by silver stain.

Biological Activity:

Not available

Endotoxin Level:

< 1 EU/µg

Amino Acid Sequence:

GAMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTRE WAKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQQASFLPATLTMTVDRGDNV NISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFT SAFTRLIVRRCEAQKWGPDCSRPCTTCKNNGVCHEDTGECICPPGFMGRTCEKACEP HTFGRTCKERCSGPEGCKSYVFCLPDPYGCSCATGWRGLQCNEACPSGYYGPDCKL RCHCTNEEICDRFQGCLCSQGWQGLQCEKEGRPRMTPQIEDLPDHIEVNSGKFNPICK ASGWPLPTSEEMTLVKPDGTVLQPNDFNYTDRFSVAIFTVNRVLPPDSGVWVCSVNTV AGMVEKPFNISVKVLPEPLHAPNVIDTGHNFAIINISSEPYFGDGPIKSKKLFYKPVNQAW KYIEVTNEIFTLNYLEPRTDYELCVQLARPGEGGEGHPGPVRRFTTASIGLPPPRGLSLL PKSQTALNLTWQPIFTNSEDEFYVEVERRSLQTTSDQQNIKVPGNLTSVLLSNLVPREQ YTVRARVNTKAQGEWSEELRAWTLSDILPPQPENIKISNITDSTAMVSWTIVDGYSISSIII RYKVQGKNEDQHIDVKIKNATVTQYQLKGLEPETTYHVDIFAENNIGSSNPAFSHELRTL PHSPASADLGTRSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK

Storage/Stability:

Stable at -20°C to -80° for up to 1 year.