Recombinant Mouse TIE1 / Fc Chimera soluble

Synonyms:

Tie1, Tyrosine-protein kinase receptor Tie-1

Species:

Human

Cat. No.:

CRT802B pdf (datasheet)

Quantity/Size:

100 μg

Price:

$560.00 BUY

Description:

Recombinant mouse soluble TIE-1 was fused with the Fc part of human IgG1. The recombinant mature sTIE-1/hFc is a disulfide-linked homodimeric protein. The soluble receptor protein consists of the full extracellular domain (Val23-Glu749).

TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Mouse TIE-1 cDNA encodes a 1134 amino acid (aa) residue precursor protein with an 22 residue putative signal peptide, a 733 residue extracellular domain and a 354 residue cytoplasmic domain. Whereas two ligands have been described for TIE-2 [angiopoietin-1 (Ang1) and angiopoietin-2 (Ang2)], so far no ligand was found for TIE-1.

Entrez Symbol:

Tie1

Uniprot ID:

Q06806

Data PDF:

CRT802B

Source:

CHO cells

Molecular Weight:

105 kDa, predicted, monomer, under reducing conditions 130 kDa, apparent, due to glycosylation

Formulation:

Lyophilized from PBS .

Purity:

> 90%, by SDS-PAGE, visualized by silver stain.

Biological Activity:

Since a ligand for TIE-1 has not yet been identified, the recombinant protein was not tested for biological activity.

Endotoxin Level:

< 1 EUμg

Amino Acid Sequence:

VDLTLLANLRITDPQRFFLTCVSGEAGAGRSSDPPLLLEKDDRIVRTFPPGQPLYLARNG SHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVLYVHNSPGAHLFPDKVTHTVNKGDTA VLSAHVHKEKQTDVIWKNNGSYFNTLDWQEADDGRFQLQLQNVQPPSSGIYSATYLEA SPLGSAFFRLIVRGCGAGRWGPGCVKDCPGCLHGGVCHDHDGECVCPPGFTGTRCE QACREGRFGQSCQEQCPGTAGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPDHF GADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILSMATEVEFNIGTMP RINCAAAGNPFPVRGSMKLRKPDGTMLLSTKVIVEPDRTTAEFEVPSLTLGDSGFWECR VSTSGGQDSRRFKVNVKVPPVPLTAPRLLAKQSRQLVVSPLVSFSGDGPISSVRLHYRP QDSTIAWSAIVVDPSENVTLMNLKPKTGYNVRVQLSRPGEGGEGGWGPSALMTTDCP EPLLQPWLESWHVEGPDRLRVSWSLPSVPLSGDGFLLRLWDGARGQERRENISFPQA RTALLTGLTPGTHYQLDVRLYHCTLLGPASPPAHVHLPPSGPPAPRHLHAQALSDSEIQ LMWQHPEAPSGPISKYIVEIQVAGGSGDPQWMDVDRPEETSIIVRGLNASTRYLFRVRA SVQGLGDWSNTVEEATLGNGLQSEDPVRESRAAEEGLTRSDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Storage/Stability:

Stable at -20°C to -80° for up to 1 year.